PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G244400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 250aa    MW: 28143.5 Da    PI: 6.2537
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G244400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+eEd +lv  ++++G  +W++ ++  g+ R++k+c++rw +yl
  Sevir.1G244400.1.p 14 RGPWTPEEDRILVAHIERHGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                        89******************************99************97 PP

2Myb_DNA-binding51.62.2e-1667112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T eE++ ++++++ lG++ W++Ia++++ gRt++++k+ w++yl
  Sevir.1G244400.1.p  67 RGNFTREEEDAIIHLHTVLGNR-WSAIAARLP-GRTDNEIKNVWHTYL 112
                         89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.506961IPR017930Myb domain
SuperFamilySSF466892.47E-3010108IPR009057Homeodomain-like
SMARTSM007177.8E-141363IPR001005SANT/Myb domain
PfamPF002493.1E-151461IPR001005SANT/Myb domain
CDDcd001673.04E-111661No hitNo description
PROSITE profilePS5129425.30362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2565116IPR009057Homeodomain-like
SMARTSM007171.1E-1366114IPR001005SANT/Myb domain
PfamPF002492.7E-1467112IPR001005SANT/Myb domain
CDDcd001675.15E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDRILVAHIE RHGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEDAIIH LHTVLGNRWS AIAARLPGRT DNEIKNVWHT YLKKRLEPKP  120
ATQQAPRRKS KKQQQQQPAE IVMLDGPGST VPVSSPEQSL STSTTSSTDY SAASSVENNA  180
DSSFTSEEDY QIEDSFWSET LAMTVDSSDS FGMEREDACV EAAPSANDDM DFWLKLFMQA  240
SDMQNLSQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121175109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9734711e-164EU973471.1 Zea mays clone 399373 myb-related protein Myb4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953149.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-101MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLK3YV860.0K3YV86_SETIT; Uncharacterized protein
STRINGSi018182m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-78myb domain protein 15